Protein Info for b0004 in Escherichia coli BW25113

Name: thrC
Annotation: threonine synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF14821: Thr_synth_N" amino acids 7 to 80 (74 residues), 52.8 bits, see alignment E=5.4e-18 TIGR00260: threonine synthase" amino acids 52 to 397 (346 residues), 434.1 bits, see alignment E=1.9e-134 PF00291: PALP" amino acids 97 to 368 (272 residues), 83.1 bits, see alignment E=3.6e-27 PF24857: THR4_C" amino acids 355 to 423 (69 residues), 37.5 bits, see alignment E=3.3e-13

Best Hits

Swiss-Prot: 100% identical to THRC_ECOLI: Threonine synthase (thrC) from Escherichia coli (strain K12)

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 100% identity to eco:b0004)

MetaCyc: 100% identical to threonine synthase (Escherichia coli K-12 substr. MG1655)
Threonine synthase. [EC: 4.2.3.1]

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P00934 at UniProt or InterPro

Protein Sequence (428 amino acids)

>b0004 threonine synthase (NCBI) (Escherichia coli BW25113)
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ