Table: begin end state 1 50 non-cytoplasmic
Input: >Psyr_0057 MYELYLLRTLMALSSGHNLGRTRHWKYAVLTHLSGQVPANYQDRPRTACP
Or try the official Phobius web server, which has a different display
Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server