Table: begin end state 1 28 signal peptide 29 36 non-cytoplasmic 37 55 transmembrane 56 62 cytoplasmic
Input: >MPMX19_02120 MKAFSFWINPILAGIMAFVGLLASSRAADEAFAAGGLIVFLGCVLFIFASIGRYFDRPGS AH
Or try the official Phobius web server, which has a different display
Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server