Table:
begin	end	state
1	60	non-cytoplasmic

Input:
>GFF4802
MLRSTSDVALQIEIAIEYFRSKRLTARISDPPKVAPRLVMLRSNKPAPPPVIGAGSDAVT

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server