Table: begin end state 1 5 non-cytoplasmic 6 8 cytoplasmic 9 11 non-cytoplasmic 12 26 transmembrane 27 29 cytoplasmic 30 59 non-cytoplasmic 60 60 cytoplasmic
Input: >CSW01_15480 MLLDVQHGQFGFIKGGIIAVIWFSLSRTINCGQLNLECFEFWLPTSQLLVLDVCLFDAFA
Or try the official Phobius web server, which has a different display
Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server