Table:
begin	end	state
1	19	signal peptide
20	62	non-cytoplasmic

Input:
>CSW01_15430
MKIVLWFLARFGLSVSEAVSLLKACSAALSFQKVCLVFKVRFLRRCKFQVVSVTGALKLR
LI

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server