Table:
begin	end	state
1	90	cytoplasmic

Input:
>CSW01_04080
MLVRKVSRDLASAQARENWLAYWQHFSRDNQAFCAEINCLTPSSQAMLVKCDKDEEGVFV
IPLCQCHSNNLEGMLEIGESTEVIPFHYTL

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server