Protein Info for Xcc-8004.2079.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Outer membrane protein GumB, involved in the export of xanthan

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details PF02563: Poly_export" amino acids 70 to 144 (75 residues), 79.5 bits, see alignment E=2.7e-26 PF10531: SLBB" amino acids 151 to 204 (54 residues), 38.1 bits, see alignment E=1.7e-13 PF22461: SLBB_2" amino acids 151 to 230 (80 residues), 34.7 bits, see alignment E=2.3e-12

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to xca:xccb100_1712)

Predicted SEED Role

"Outer membrane protein GumB, involved in the export of xanthan" in subsystem Xanthan Exopolysaccharide Biosynthesis and Export

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X609 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Xcc-8004.2079.1 Outer membrane protein GumB, involved in the export of xanthan (Xanthomonas campestris pv. campestris strain 8004)
VLAPEPVECCARSCPTQQRQPATRMKKLIGRLCQGLSLALLCSMSLGACSTGPEMASSLP
HPDPLAMSTVQPEYRLAPGDLLLVKVFQIDDLERQVRIDQNGHISLPLIGDVKAAGLGVG
ELEKLVADRYRAGYLQQPQISVFVQESNGRRVTVTGAVDEPGIYPVIGANLTLQQAIAQA
KGVSTVASRGNVIVFRMVNGQKMIARFDLTEIEKGANPDPEIYGGDIVVVYRSDARVWLR
TMLELTPLVMVWRAYR