Protein Info for Rv2593c in Mycobacterium tuberculosis H37Rv

Annotation: Probable holliday junction DNA helicase RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 190 (190 residues), 132.1 bits, see alignment E=8.9e-43 PF01330: RuvA_N" amino acids 1 to 61 (61 residues), 77.8 bits, see alignment E=7.8e-26 PF14520: HHH_5" amino acids 71 to 129 (59 residues), 53.6 bits, see alignment E=3.8e-18 PF07499: RuvA_C" amino acids 151 to 192 (42 residues), 39.4 bits, see alignment 1.1e-13

Best Hits

Swiss-Prot: 100% identical to RUVA_MYCTU: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 100% identity to mra:MRA_2622)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>Rv2593c Probable holliday junction DNA helicase RuvA (Mycobacterium tuberculosis H37Rv)
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLY
GFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGA
ERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDAT
TSSALRSALSLLGKAR