Protein Info for Rv0204c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 38 to 62 (25 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 149 to 177 (29 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 288 to 319 (32 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 44 to 346 (303 residues), 136.9 bits, see alignment E=5.3e-44 TIGR00374: TIGR00374 family protein" amino acids 48 to 355 (308 residues), 44.6 bits, see alignment E=6.3e-16

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 100% identity to mtf:TBFG_10206)

Predicted SEED Role

"FIG01121868: Possible membrane protein, Rv0204c"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>Rv0204c Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
VSHDAPARNLRQRVGALPRTRVGAPPAEGVPPRGKYWWLRWAVLAIVAIVLAIEVALGWD
QLAKAWVSLYRAKWWWLLAAVAAAGASMHSFAQIQRTLLKSAGVHVKQWRSEAAFYAANS
LSTTLPGGPVLSATFLLRQQRIWGASTVVASWQLVMSGVLQAVGLALLGLGGAFFLGAKN
NPFSLLFTLGGFVTLLLLAQAVASRPELIEGIGRRVLSWANSVRGRPADAGLPKWRETLM
QLESVSLGRRDLGVAFGWSLFNWIADVACLGFAAYAAGDHASVGGLAVAYAAARAVGTIP
LMPGGLLVVEAVLVPGLVSSGMPLPSAISAMLIYRLISWLLIAAIGWVVFFFMFRTESTA
DSDNDRDPPTDPNLRLVIQPQGTPCDDPVETTPQGPAPTPDLRPEGGETPPR