Protein Info for RR42_RS27400 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details PF00892: EamA" amino acids 20 to 151 (132 residues), 66 bits, see alignment E=2.1e-22 amino acids 161 to 287 (127 residues), 32.8 bits, see alignment E=4e-12

Best Hits

KEGG orthology group: None (inferred from 68% identity to vap:Vapar_5229)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLQ8 at UniProt or InterPro

Protein Sequence (316 amino acids)

>RR42_RS27400 membrane protein (Cupriavidus basilensis FW507-4G11)
MTGPANSSLRLTTARARRDGILLFFCALVAFASYDAFCKWMLRDHSAPMMNLTRYVSVSV
IALVWLLREGGLRLWRTPCKWLLLVRGLALGIVASCFMAALVHMPLAEATAIYFTAPLIM
VALSPAVLGERVGRAQWAAVLAGFGGMLLIVRPGGDLPLAGTVLMMVSAVCYAAFQLLTR
RLAGVVAGPVLYAWTALICLVVTGVPALATLPQVMPRAPDLLLMMAGGACSGLAQLLLLA
AFRRVAASTLAPLNYFQLLLAVLISTFVFQRPPDGIALAGIVLIMLSGGYLALRGRQAPP
APPAPLVKPVVARPKD