Protein Info for Psyr_5133 in Pseudomonas syringae pv. syringae B728a

Annotation: tRNA modification GTPase trmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF10396: TrmE_N" amino acids 7 to 120 (114 residues), 136 bits, see alignment E=1.7e-43 TIGR00450: tRNA modification GTPase TrmE" amino acids 12 to 456 (445 residues), 353 bits, see alignment E=2.9e-109 PF12631: MnmE_helical" amino acids 123 to 453 (331 residues), 202.1 bits, see alignment E=3e-63 TIGR00231: small GTP-binding protein domain" amino acids 217 to 350 (134 residues), 67.7 bits, see alignment E=1.1e-22 PF01926: MMR_HSR1" amino acids 218 to 308 (91 residues), 85.2 bits, see alignment E=9e-28 PF02421: FeoB_N" amino acids 218 to 309 (92 residues), 36 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 100% identical to MNME_PSEU2: tRNA modification GTPase MnmE (mnmE) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 100% identity to psb:Psyr_5133)

MetaCyc: 67% identical to 5-carboxymethylaminomethyluridine-tRNA synthase GTPase subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZL12 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Psyr_5133 tRNA modification GTPase trmE (Pseudomonas syringae pv. syringae B728a)
MNVPRETIAAIATAQGRGGVGIIRVSGPLAGKAAEAIIGRTLKPRFAHYGPFVDGTGQVL
DEGIALYFPGPNSFTGEDVLELQGHGGPIVLDMLLQRCLQLGSRLARPGEFSERAFLNDK
LDLAQAEAIADLIEASSAQAARNALRSLQGAFSRRVDNLTEKLISLRIYVEAAIDFPEEE
IDFLADGHVLNMLDDVRAELSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGRE
AAIVTEIAGTTRDVLREHIHIDGMPLHVVDTAGLRDTQDQVEMIGVQRALKAIGEADRIL
LVVDATAPEAADPFALWPEFLEQRPDPSKVTLIRNKADLSGDPINLQTSVDGHVTISLSA
RSGGEGLELLREHLKACMGYEQTSESSFSARRRHLEALRHASDSLEHGRAQLTLAGAGEL
LAEDLRQAQQALGEITGAFSSDDLLGRIFSSFCIGK