Protein Info for Psyr_4735 in Pseudomonas syringae pv. syringae B728a

Annotation: GTP-binding protein, HSR1-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 337 to 357 (21 residues), see Phobius details PF01926: MMR_HSR1" amino acids 12 to 157 (146 residues), 53.9 bits, see alignment E=1.8e-18 PF11981: DUF3482" amino acids 170 to 456 (287 residues), 384.8 bits, see alignment E=3e-119

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4735)

Predicted SEED Role

"probable integral membrane protein NMA1898"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM60 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Psyr_4735 GTP-binding protein, HSR1-related protein (Pseudomonas syringae pv. syringae B728a)
MTEADGTRAIKLAVVGHTNVGKTSLLRTLTGDVSFGEVSHRPSTTRHVEGARLSVDGQAV
VELYDTPGLEDAIALLDYLERLDRPGERLDGPARLARFLEGNEARQRFEQEAKVMRQLLD
SDAGLYVIDAREPVLAKYRDELAVLASCGKPLLPVLNFVSAQQHREPEWREALSRLGLHA
LVRFDSVAPPEDGGRRLYESLALLLESARPRLERLIDDQEKQRSAKRHSAARLIAELLID
CAACRRSVETTADQEQQAVEALRKAVRQREQQCVEALLKLYAFRKDDVSSSDLPLMDGRW
GDDLFNPETLKLMGVRVGGGVAAGAAAGAGVDLMVGGVTLGAAALVGAIAGGALSTARSY
GGRLLGKLKGRRELTVDDAVLRLLALRQRHLLLALGVRGHAALHSIELTTPQDKTWRKGK
IPEPLSRARAHPQWSTLNPHPKPNQAERQEAIVELADVVLQD