Protein Info for Psyr_3441 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar biosynthetic protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 89 to 118 (30 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 335 to 349 (15 residues), see Phobius details PF01312: Bac_export_2" amino acids 8 to 348 (341 residues), 418.4 bits, see alignment E=1.2e-129 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 353 (346 residues), 392.4 bits, see alignment E=1e-121

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to psb:Psyr_3441)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQU9 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Psyr_3441 Flagellar biosynthetic protein FlhB (Pseudomonas syringae pv. syringae B728a)
MAENENGQDKTEDPTEKKVKDSRADGQIARSKELTTLVVMLMGAGGLLMFGSDIALMMSE
LMRDNFTISRETLMDQSYMGKALLSSGMHALVVVLPFLIAMLVAALVGPIMLGGWLFATK
SLMPKFSRMNPAAGLKRMFSPHALVELLKSFGKFLITLAVALVVLNNERKDLVAIAHEPL
EQAMIHSLVVVGWSSFWMACGLIFIAAADVPFVLYEAHKKLLMTKQEVRDEHKNSEGSPE
VKQRIRQLQREMSQRRMMASVPEADVIITNPTHFAVALKYDPEQGGAPMLLAKGTDLVAL
KIREIGAHNEILILESAALARSIYYSTELDQEIPAGLYLAVAQVLAYVYQIRQFRAGQGK
RPDPLGDIKIPPDLQRDA