Protein Info for Psyr_2943 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein 2, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 160 to 173 (14 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 111 (99 residues), 74.6 bits, see alignment E=3.7e-25 PF00528: BPD_transp_1" amino acids 47 to 216 (170 residues), 59.3 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 100% identity to psb:Psyr_2943)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS95 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Psyr_2943 amino acid ABC transporter membrane protein 2, PAAT family (Pseudomonas syringae pv. syringae B728a)
MASSGLELLWVSAPQLITGAGRTLGISLLAIVFSSIGGVGYGVLRSLGKRWLEVPLRIYL
ELFRAIPVLVWLYLFFFGLPIFLGVSIPAFWCAVLVLSLWGASEVGEVVRGGLRSIPRGQ
REAGLAIGLGLGQLYGRVLLPQALKRLTPPVINVYTRLIKTSSLAVLIGVVDVTKVGQQI
IERTYESVLIYGFLFLFFFIVCYPLSAASRVLERRWNHA