Protein Info for Psyr_2761 in Pseudomonas syringae pv. syringae B728a

Annotation: DNA-directed DNA polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF00817: IMS" amino acids 11 to 153 (143 residues), 121.3 bits, see alignment E=5.1e-39 PF11799: IMS_C" amino acids 248 to 355 (108 residues), 59.4 bits, see alignment E=6.8e-20 PF13438: DUF4113" amino acids 373 to 423 (51 residues), 61.8 bits, see alignment 7.8e-21

Best Hits

Swiss-Prot: 48% identical to UMUC_ECOLI: Protein UmuC (umuC) from Escherichia coli (strain K12)

KEGG orthology group: K03502, DNA polymerase V (inferred from 100% identity to psb:Psyr_2761)

MetaCyc: 48% identical to DNA polymerase V catalytic protein (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone, lesion bypass DNA polymerase V (UmuC)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSS2 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Psyr_2761 DNA-directed DNA polymerase (Pseudomonas syringae pv. syringae B728a)
MAGHENVFALIDCNCFYASCERAFRPDLAKTPIVVLSNNDGCVIARSYDAKPFVKMGAPY
FQIKDVLRQNGVIAFSSNYALYGDMSERVMTIIESMVPASEVYSIDEAFADLTGIPGDMT
EFGRRIRSKILKCTGIPVGVGIGPTKTLAKLANHTAKRLLAQTGGVVDICDLHKRNWVLR
NTCVSEVWGVGKKMKAHLEAMNIRSAMDLANADARTLRTKFSVVIEKTARELAGTSCLEM
SEADPPKQEICSSRMFGQRLTTIEPIKEAVATYTQRAAEKLRAQNSLCKKMRVSIRTGMF
NPDEPKYANGALVELPYPTNDVRLLTKGATEAVNRLFRPGYKYSKAEVLLLDLRQPGEFT
DDLFAESQPAAVEKVMGVLDEINALWGRGTLRAGSVPSDPDWAMRRDMMSQSYTTRLDQL
WVVRAY