Protein Info for Psyr_0897 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 258 to 275 (18 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details PF00892: EamA" amino acids 12 to 143 (132 residues), 38 bits, see alignment E=1e-13 amino acids 163 to 298 (136 residues), 37.1 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0897)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY17 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Psyr_0897 Protein of unknown function DUF6 (Pseudomonas syringae pv. syringae B728a)
MSAPALFPRHIAVLILALLACSFAGNHIAARIAFDHDTGLLLAILCRSGVTLLVLVSLVL
WQRERLSLPASTWRWQLLLGLLIATQSFCIYSAVARIPVALALLVVNVSPILLALLTWAL
GGARPTRRAAGLMGLILFGLTLALDVPQRLSNPGSSEPQWLEGVVYASTAAVVFAFALWI
TDNKLAGMRGSVRSMLTMAVVFVVAAIAGSSGVLPGGVGLPTSSVGWSALASLVVLYGLG
FSLLFICMARLDIARNAPVMNIEPVASLLFGWLILDQLLSSGQVVGGLIVVSGIVLLTWR
RARSPDPQSSRKALKHVHERTDP