Protein Info for Psyr_0017 in Pseudomonas syringae pv. syringae B728a

Annotation: 16S rRNA m(5)C-967 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01029: NusB" amino acids 1 to 123 (123 residues), 89 bits, see alignment E=5.6e-29 TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase" amino acids 7 to 435 (429 residues), 409.5 bits, see alignment E=1.1e-126 PF22458: RsmF-B_ferredox" amino acids 142 to 215 (74 residues), 108.3 bits, see alignment E=2.6e-35 PF01189: Methyltr_RsmB-F" amino acids 238 to 433 (196 residues), 208.8 bits, see alignment E=1e-65

Best Hits

Swiss-Prot: 97% identical to RSMB_PSESM: Ribosomal RNA small subunit methyltransferase B (rsmB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to psb:Psyr_0017)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500T1 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psyr_0017 16S rRNA m(5)C-967 methyltransferase (Pseudomonas syringae pv. syringae B728a)
MNPRLAAAKALAAVLSGKASLNSSLPTQLDKVEVRDRGLTQDLAFGTARWQPRLSALAAK
LLQKPFKAADADVEALLLVGLYQLFYSRIPAHAAIGETVGCADKLKKPWAKGLLNAVLRN
AQRDGEALLIELEHDPVVRTAHPRWLQKALKAAWPEQWEAICAANNAHPPMILRVNRRHH
RRDQYLELLDTAGLQASACTFSQDGIVLAEPCDVRSLPGFAEGWISVQDEAAQLAADLLE
LAPGQRVLDACCAPGGKTCHLLEVQPQLDGVVAVDLEAKRLVRVRENLDRLGLDAELIAA
DARETAQWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQADDIAALAALQGELLDALWP
TLQVGGMLVYATCSTLPTENTDVIEAFLARTSGARELDIAGQAGQPPAGIKQAHGRQLLA
QQGGHDGFYYAKLIKIADQDRGGAGVSA