Protein Info for Pf6N2E2_5544 in Pseudomonas fluorescens FW300-N2E2

Annotation: TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF16331: TolA_bind_tri" amino acids 37 to 92 (56 residues), 34 bits, see alignment E=7.9e-12 TIGR02795: tol-pal system protein YbgF" amino acids 134 to 251 (118 residues), 135.5 bits, see alignment E=6.9e-44 PF13174: TPR_6" amino acids 138 to 167 (30 residues), 16.6 bits, see alignment 3e-06 amino acids 173 to 203 (31 residues), 17.3 bits, see alignment 1.8e-06 amino acids 209 to 240 (32 residues), 21.2 bits, see alignment 1e-07

Best Hits

Swiss-Prot: 81% identical to CPOB_PSEPU: Cell division coordinator CpoB (cpoB) from Pseudomonas putida

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_c2g93)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A5P3 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Pf6N2E2_5544 TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain (Pseudomonas fluorescens FW300-N2E2)
VVDNDAGYNNSGSSYPPAGYGTNGAYAGGGVSAPVSAQGQLFNQLQQMQDQISRQQGVIE
ELQNDISRMKQENLERYQDLDRRIGTGVAPAPAATPENSPAGGDLNAPGAAAGAGAAAPA
APAAGGEPADPAKEKLYYDAAFDLIKAKDFDKASQAFAAFLRKYPNSQYAGNAQYWLGEV
NLAKGDLQGAGQAFAKVSQLYPKHAKVPDSLYKLADVERRLGHTDKVKGILQQVVAQYPG
TSAAQLAQRDLQRM