Protein Info for Pf6N2E2_5479 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC spermidine/putrescine transporter, inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 271 (171 residues), 59.2 bits, see alignment E=2.3e-20

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to pba:PSEBR_a4498)

Predicted SEED Role

"ABC spermidine/putrescine transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1Z3 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Pf6N2E2_5479 ABC spermidine/putrescine transporter, inner membrane subunit (Pseudomonas fluorescens FW300-N2E2)
MTALSKKRQSLLPGETGRAVGLLSGFILLLAVLPILTMIVMSFSGAANLDFPPSSYSLQW
YRAAWHTFVSPDASDVLSLGQAMGTSLLVACLTMIFATLIAVPAAYALTRCEFRGKAVAL
QLMSLPLVFPMVVLGLALLLVFDSLPFQMTTSRLVIAHVILALPFVVKNCTAAMLGIGSE
VEEAARMLGATPRRAIVDVVVPLMKSGILAGMLLAFIVSFNEFTVTYFLYTIDVMTVPIW
MYSRTVSSLDPTVFSFAVLIVLIDFVLIWALEKLVGEGGVSF