Protein Info for Pf6N2E2_3723 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG022199: FAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF04820: Trp_halogenase" amino acids 10 to 94 (85 residues), 43.1 bits, see alignment E=9.8e-15 amino acids 102 to 360 (259 residues), 42.1 bits, see alignment E=1.9e-14 PF12831: FAD_oxidored" amino acids 10 to 172 (163 residues), 32.8 bits, see alignment E=1.7e-11 PF01494: FAD_binding_3" amino acids 10 to 335 (326 residues), 64.1 bits, see alignment E=5e-21 PF13450: NAD_binding_8" amino acids 13 to 42 (30 residues), 30.9 bits, see alignment (E = 9.5e-11)

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a446)

Predicted SEED Role

"FIG022199: FAD-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A190 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Pf6N2E2_3723 FIG022199: FAD-binding protein (Pseudomonas fluorescens FW300-N2E2)
VPTVEMERRQVVIIGAGPSGAIAAALLKRKGHEVLVIERQHFPRFSIGESLLSHCLDFVE
EAGMLDAVNAAGFQRKNGAAFAWGERYSAFDFGDTFSNGKPTTFQVQRADFDKLLADQAA
LQGVEIRYGQAITSADFSLAKPQLGVQREDGSEYCVEADFVLDASGYGRVLPRLLDLEAP
SNFPVRQAVFTHIEDRIDAPAFDREKILITTHPSKRDVWFWTIPFSGGRCSVGVVAAAEH
FAGRTDDLDACLRGFIDETPSLAGVLKNAVWDTPARTIGGYSANVKTLHGPGFALLGNAA
EFLDPVFSSGVTIAMRSASMAADVLHRQLQGESVDWQSEFAEPLKRGVDTFRCYVEGWYA
GTFQDVIFYTEGSDDIRRMISSILAGYAWDQRNPFVSEPKRRLRMLSEICASPAP