Protein Info for Pf6N2E2_3678 in Pseudomonas fluorescens FW300-N2E2

Annotation: Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 52 to 204 (153 residues), 218.2 bits, see alignment E=3.4e-69 PF01625: PMSR" amino acids 52 to 204 (153 residues), 208.9 bits, see alignment E=2.4e-66

Best Hits

Swiss-Prot: 82% identical to MSRA_PSEU2: Peptide methionine sulfoxide reductase MsrA (msrA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 98% identity to pba:PSEBR_a479)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A066 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Pf6N2E2_3678 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Pseudomonas fluorescens FW300-N2E2)
MVLRSEILVNKNVLPTQEQALPGRETPMTVPDKHFVLDAPLLGPFAMDVDFAIFGLGCFW
GAERKFWQREGVVSTAVGYAGGFTPNPTYEEVCSGLTGHSEVVLVVYEPAKVSYEQLLKM
FWELHNPTQGMRQGNDIGTQYRSVIYATTPAQLAAAKHSEQVFQAELTKAGKGTITTEIE
EAPTFYFAEAYHQQYLAKNPEGYCGIGGTGVTCPI