Protein Info for Pf6N2E2_3612 in Pseudomonas fluorescens FW300-N2E2

Annotation: HflK protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 67 to 89 (23 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 50 (50 residues), 67.3 bits, see alignment 8.8e-23 TIGR01933: HflK protein" amino acids 86 to 348 (263 residues), 376.8 bits, see alignment E=2.7e-117 PF01145: Band_7" amino acids 88 to 260 (173 residues), 97.9 bits, see alignment E=7.4e-32

Best Hits

Swiss-Prot: 44% identical to HFLK_VIBCH: Protein HflK (hflK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 98% identity to pba:PSEBR_a543)

MetaCyc: 42% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZHD3 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Pf6N2E2_3612 HflK protein (Pseudomonas fluorescens FW300-N2E2)
MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNGLFGGGKKRGDDGGGR
PGKGGGFGLLGIGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETVGPGLNIYFPPIDQ
KYMENVTRERAYTKQGQMLTEDENIVEVPLTVQYKITNLQDFVLNVDQPEISLQHATESA
LRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAF
DDVIRAREDEQRSRNQAETYANGVVPEARGQAQRIIEDANGYRDEVVSRAKGEADRFTKL
VAEYRKAPEVTRERLYLDTMQEVFSNTSKVLVTGNKNGQSNLLYLPLDKMVESGRNTSTP
PASSAAASNEAGTRAAADLQQQQARTRESR