Protein Info for Pf6N2E2_2298 in Pseudomonas fluorescens FW300-N2E2

Annotation: Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 36 to 59 (24 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 227 to 253 (27 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 331 to 355 (25 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 7 to 403 (397 residues), 351.8 bits, see alignment E=2.3e-109 PF01554: MatE" amino acids 7 to 166 (160 residues), 131.6 bits, see alignment E=1.1e-42 amino acids 233 to 393 (161 residues), 123.5 bits, see alignment E=3.5e-40

Best Hits

Swiss-Prot: 72% identical to PMPM_PSEAE: Multidrug resistance protein PmpM (pmpM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 99% identity to pba:PSEBR_a1738)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV95 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Pf6N2E2_2298 Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps (Pseudomonas fluorescens FW300-N2E2)
LLALALPIMVAQLATTAMGFVDAVMAGRVGPRDLAAVALGNSIWVPVFLLMTGTLLATTP
KVAQRFGAGTFAEIGPLVRQALWLALVVGLIASLALFSAEPILHIMNVDPELIGPCMEYL
RGIGTGLPAVALYHVLRCFSDGLGRTRPAMVLGLCGLALNIPLNYIFIYGHLGVPAMGGV
GCGWATAIVMWVMALGMAGWARWAPAYQSSRLFSRFDWPQWAVIKRLLGIGLPIGIAVFA
ESSIFAVIALLIGSLGATVVAGHQIALNFSSLVFMIPYSLGMAVTVRVGQALGRAQPREA
RFAAGVGMGTALAYACLSASLMFALRGPIAAIYTADPVVIEVASMLIVYAALFQFSDAIQ
VTAAGALRGYQDTRVTMILTLFAYWGIGLPVGYALGLTDWLGAASGPSGLWQGLIVGLSC
AALMLSIRLARSARKQIRISRSTD