Protein Info for Pf6N2E2_1733 in Pseudomonas fluorescens FW300-N2E2

Annotation: Oligopeptide transporter, OPT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 215 to 241 (27 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details amino acids 482 to 503 (22 residues), see Phobius details amino acids 515 to 540 (26 residues), see Phobius details amino acids 552 to 574 (23 residues), see Phobius details PF03169: OPT" amino acids 18 to 574 (557 residues), 350.9 bits, see alignment E=8.3e-109

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2261)

Predicted SEED Role

"Oligopeptide transporter, OPT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZU24 at UniProt or InterPro

Protein Sequence (581 amino acids)

>Pf6N2E2_1733 Oligopeptide transporter, OPT family (Pseudomonas fluorescens FW300-N2E2)
MHPTSSTFPLTTAVERELSPRAVSTGIVLGILLTPSNVYAGLKIGWSFNMSIIALLVGYG
IWQGLASRSVGRLPWTLHESNINQTVASAAASIISGGLVAPIPAYTLLTGQQLDAIPMVA
WVFSVSFLGIWIAWYLRPSLLNDKALKFPEGMATLETLLHIYNHGHEAATRLKVLLSAAL
LSGLVKAVDTFMWAIPRWSPSAQLERLTFTADPSLLLVGFGGIIGIRVGLTLLLGALLAW
GGLAPWLLGQGLVRLPHGSSGPQFAALVEWLLWPGVSLMVCSTLASLAIRLWALHRSTKA
GGGAIWTIPKPGPAVGFMLSIILVVSLQVLLFGINPWMALLTIPLAICLAAVAARVVGAT
GIPPIGAIGQLSQLSFGIVAPGQVPINLMSANTAGGSAGQCTDLMNDFKVGRAIGATPRK
QLIAQTLGIFVGSIVGVLAYLALIPDPPTMLLTEEWPAPAVATWKAVAQTLTLGLDSLSA
SIRWAIFIGGLIGLLLGILDSLLPAHRARYLPSTAALGLAFVLPASVSLMMALGAVLTWL
VSCRWPSLTERFAITAAAGLIAGESITGVGASLWQMLTNGS