Protein Info for Pf6N2E2_1626 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative ATP-binding component of a transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 6 to 534 (529 residues), 404.9 bits, see alignment E=2.7e-125 PF00664: ABC_membrane" amino acids 15 to 195 (181 residues), 49 bits, see alignment E=7.2e-17 PF00005: ABC_tran" amino acids 345 to 482 (138 residues), 94.6 bits, see alignment E=8.3e-31

Best Hits

KEGG orthology group: K06159, putative ATP-binding cassette transporter (inferred from 43% identity to nhl:Nhal_1784)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXS9 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Pf6N2E2_1626 Putative ATP-binding component of a transport system (Pseudomonas fluorescens FW300-N2E2)
MMLLKELLHDARWRILLAILSSALSAATSIGLIGYINRSLEHGLDDIGRGLLLFGGLLIL
LFISGVTSQWLLVQIGHRLVYQLRLRLVGKVLGTALERIERLGSPRIYNALTKDVTTVAT
AFKQLPISLYNGLLLLAGLAYMAWLSMPFFFLTLGVIALGVGLDVLLGRKVKTLMQAVRQ
QDDQLTEQFEAAIQGRCELGLSRERRHLLYERKLEPIARASLEASVRADTLWAVNLNWTT
LLVFVLIGTLFFLGQGLGLLSQQVVVGYVLAIMFLRTPISMILDAIPAVIRGHVALQAID
ALALGETVQFKTPAQAAQPFGELRLSNVHYRYPGQSDEFAFELGPIDLSIRRGELIFIVG
GNGSGKSTLAKLLTGLYVPTSGQVSLNGVVLDTHTGEWHREHFAAIFADFYLFADVLGEA
GNHEGLEARVDHYLDRLGLAHKVEFAAGRLSTTALSQGQRKRLALLLLMMEGREVFLLDE
WAADQDPVFRHVFYNELLPELKAAGKTVIAITHDDRYFDVADRVYRLDYGHLVDYDRATE
NPFQLAK