Protein Info for Pf6N2E2_1505 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transporter, MFS superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details amino acids 26 to 26 (1 residues), see Phobius details transmembrane" amino acids 53 to 75 (23 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details PF07690: MFS_1" amino acids 1 to 290 (290 residues), 128.9 bits, see alignment E=3.3e-41 PF00083: Sugar_tr" amino acids 19 to 171 (153 residues), 61.6 bits, see alignment E=1e-20 amino acids 191 to 381 (191 residues), 43 bits, see alignment E=4.4e-15

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2546)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVT2 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Pf6N2E2_1505 Transporter, MFS superfamily (Pseudomonas fluorescens FW300-N2E2)
MFGLAIPALIAAFALSKGDAGLVSGVTLVTSAIGGWVGGTLSDRYGRVRTLQWMILWFSF
FTFLSAFVTGFHQLLIVKALQGFGIGGEWAAGAVLMAETINPKYRGKVMGTVQSAWAVGW
GLAVGVFTLIYSLVPQDMAWRVMFVVGLLPSFLIIWVRRNVEEPDSFQRLKKDNVIPQSF
FKSLAGIFRPELIRVTLFGGLLGLGAHGGYHAVMTWLPTFLKTERNLSVLNSGGYLAVII
FAFWCGCVVSGLLIDRIGRRKNIVLFALCCVVTVQCYVFLPLTNTQMLFLGFPLGFFAAG
IPASLGAFFNELYPADVRGAGVGFCYNFGRVLSAMFPFLVGHMSDSMSLGSAIGIDAGIA
YGVAVIAALCLPETRGRSLEATAASAPVVESDGQGARA