Protein Info for Pf6N2E2_1322 in Pseudomonas fluorescens FW300-N2E2

Annotation: MoaE protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF08659: KR" amino acids 6 to 161 (156 residues), 31.6 bits, see alignment E=2.3e-11 PF00106: adh_short" amino acids 6 to 188 (183 residues), 164.3 bits, see alignment E=3.7e-52 PF13561: adh_short_C2" amino acids 11 to 248 (238 residues), 200.9 bits, see alignment E=3.6e-63

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2729)

Predicted SEED Role

"MoaE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUX0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Pf6N2E2_1322 MoaE protein (Pseudomonas fluorescens FW300-N2E2)
MPESRTVVITGAGTGIGAACARLYAAEGANLVLIGRRREPLEALAEDIGGLVLVGDAACP
NTWDGFVEQIRKRHGRLDVLLACAGGMGMGSATETHPSAWEAALRSNLDSAFYSARACLP
LLKESAGNIVLIASIASLAAGPHVCGYTTAKHALLGLNRSLARDYGPHGVRVNAICPGWV
RTPMADEEMQALMQFHGETLQQAYDRVCADVPLRRPASAEEIANVCRFLASPDASIITGA
TLVADGGSSIVDVPTLAFSRMEASDV