Protein Info for Pf6N2E2_1251 in Pseudomonas fluorescens FW300-N2E2

Annotation: Similar to non-heme chloroperoxidase, sll5080 homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00561: Abhydrolase_1" amino acids 23 to 258 (236 residues), 119.3 bits, see alignment E=5.8e-38 PF12146: Hydrolase_4" amino acids 24 to 125 (102 residues), 53.4 bits, see alignment E=5.7e-18 PF12697: Abhydrolase_6" amino acids 27 to 265 (239 residues), 66.6 bits, see alignment E=1.3e-21 PF00326: Peptidase_S9" amino acids 151 to 274 (124 residues), 27.5 bits, see alignment E=5.2e-10

Best Hits

Swiss-Prot: 68% identical to PRXC_PSEFL: Non-heme chloroperoxidase (cpo) from Pseudomonas fluorescens

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 78% identity to bpy:Bphyt_6690)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUM9 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Pf6N2E2_1251 Similar to non-heme chloroperoxidase, sll5080 homolog (Pseudomonas fluorescens FW300-N2E2)
MTTIVTKEGVELYYKDWGPKDGPVVTLSHGWPLNADSWDYQAYFLASHGFRVIAHDRRGH
GRSSQPWDGNDMDHYADDLATVINTLNLRNVTVIGFSTGGGEVARYIGRHGTSRVAKIGL
ISAVPPLMLKTAKNPGGLPIDVFDGIRNGMLADRSQIFKDIPAGPFYGFNRPGSKTSQGM
IDAWWMQGMTGGFKNTFDSVKAFSETDFTDDLKKFDKPTLIIHGDDDQIVPIDAAGRASK
KLIPDALLKVYPGAPHGLTETHKDQCNQDLLAFLHS