Protein Info for PagCFBP13505_RS12265 in Pantoea agglomerans CFBP13505 P0401

Annotation: 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details PF00892: EamA" amino acids 11 to 102 (92 residues), 44.9 bits, see alignment E=7.3e-16

Best Hits

Swiss-Prot: 64% identical to ARNE_ERWT9: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K12962, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE (inferred from 97% identity to pva:Pvag_pPag10067)

Predicted SEED Role

"Polymyxin resistance protein PmrL, sucrose-6 phosphate hydrolase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>PagCFBP13505_RS12265 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase (Pantoea agglomerans CFBP13505 P0401)
MLLLIVLVSLLSCSAQLCQKQATHAASRRVRLSWIGVSVLLLGVAMLLWLLVLQRVPVSQ
AYPMLSLNFIFVALAGRILWRESLTLRQIAGTLLVVTGVALMASQL