Protein Info for MPMX20_04041 in Enterobacter sp. TBS_079

Annotation: N-acetylgalactosamine permease IIC component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 23 (5 residues), see Phobius details amino acids 35 to 61 (27 residues), see Phobius details amino acids 72 to 88 (17 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 208 to 236 (29 residues), see Phobius details PF03609: EII-Sor" amino acids 5 to 236 (232 residues), 245.3 bits, see alignment E=3e-77

Best Hits

Swiss-Prot: 36% identical to PTPC1_ECOLI: N-acetylgalactosamine permease IIC component 1 (agaC) from Escherichia coli (strain K12)

KEGG orthology group: K02746, PTS system, N-acetylgalactosamine-specific IIC component (inferred from 98% identity to cko:CKO_04532)

Predicted SEED Role

"PTS system, N-acetylgalactosamine-specific IIC component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>MPMX20_04041 N-acetylgalactosamine permease IIC component 1 (Enterobacter sp. TBS_079)
MEISLLQAFALGILAFIAGLDMFNGLTHMHRPVVLGPLVGLILGDLHTGILTGGTLELVW
MGLAPLAGAQPPNVIIGTIVGTTFAISTGVKPDVAVGVAVPFAVAVQMGITFLFSVMSGV
MSRCDRMAANADTNGIERVNYLALLALGIFYFLCAFLPIYFGAEHAKTAIDVLPERLIDG
LGVAGGIMPAIGFAVLLKIMMKNVYIPYFIIGFVAAAWLKLPVLAIAAAALAMALIDLMR
KSPEPATPAAQKEEFEDGI