Protein Info for MPMX19_06900 in Azospirillum sp. SherDot2

Annotation: Nucleoid occlusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02195: ParBc" amino acids 13 to 97 (85 residues), 60.3 bits, see alignment E=8.2e-21 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 17 to 180 (164 residues), 92.5 bits, see alignment E=1.4e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>MPMX19_06900 Nucleoid occlusion protein (Azospirillum sp. SherDot2)
MSLAAMGDAACIAVAAIAVPDSHARRRIDDDGLDSLARSIEEVGLLQPIMVRPLGNGRYE
LLAGARRLRAMQALGRAGVPAVPVTNESAAVLSLVENMQRQGLDALELAEALQRLVERGW
GREALARLVGRSTSWIGDMLGLNRLPDWIKMEYPQARRVVSRSLLVEIARVRDASAQAEL
WRQAVGGALTVRQARRMRREALPAVPRALSAVRRCVRQLDRIDTAPDLAEKDRSALLALR
DRIDLLLGAGGGAESGNQARGFLVDRLQAGDGLAAADAR