Protein Info for MPMX19_06242 in Azospirillum sp. SherDot2

Annotation: Fe(3+)-pyochelin receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF07715: Plug" amino acids 86 to 185 (100 residues), 73.6 bits, see alignment E=1.8e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 88 to 739 (652 residues), 386.1 bits, see alignment E=1.9e-119 PF00593: TonB_dep_Rec_b-barrel" amino acids 304 to 709 (406 residues), 182.1 bits, see alignment E=3.6e-57

Best Hits

Predicted SEED Role

"TonB-dependent siderophore receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (741 amino acids)

>MPMX19_06242 Fe(3+)-pyochelin receptor (Azospirillum sp. SherDot2)
MTIDRQPGRLGRQNRGRVRLLASVAAAALLLPALALAQATTNTGTTASSGAMSSGAMTLP
TIDVGADRQRDANPPTTVGSKLPLAPREVPQTVTTMPRERIEEQKLITLEDAMKQTPGVT
VELIDGNRLQFYSRGFEMTNLQFDGVPTTLDSRIFASPDLAMYERVEVLKGPAGLLNGMG
GPGGAINLVRKTPKKTLEGYGELTAGSYANYRGEGDITGPLNQSGSLRGRFVGAYQDRNG
FQDWTTQDRAVAYGSIAADLTPDTTLTAGAWYQRMSYKGAWNLPGYATVVNGQPQFRLLD
VDRSTSLGEEWNRDIFTTKGGFADLEHRFDNGWAVKLATHYIDNEMDRKMAYAYSPVTPG
VNRTTLYAQKVRYDQDQIGADLSASGNFGLFGQTHEAAVGTNYERWTFRHRAANPVGSWS
VTQNIFAPNASAPEPAWRNWQRDTKTTTDSWGTYGVLRLKLADPLKLIVGGRMNWWQTKV
DADALAGTAESSASVRGKVTPYAGLVYEVNSTYALYTSVTQMYQPQSFVDASGKVLEPLK
GRQYEAGVKADYFGGRLHATASVFHIEEENRPQSDPRYPNQSIYISGGKAQSRGFELDVS
GEILPGWDAYAGYTFTRAKSLDSSANSGSAFTAIAPMHQFKLWTNYRLPESIDDRLSVGG
GVTAQTSMYNEFPSLGGARLTQGGYATVDARVAYDVTEKVTAAVNVKNLFDRTYYQRINN
VQSGNIYGEPRTVLLTLRAKL