Protein Info for MPMX19_06071 in Azospirillum sp. SherDot2

Annotation: Nitric oxide reductase transcription regulator NorR2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF01590: GAF" amino acids 30 to 174 (145 residues), 29.2 bits, see alignment E=3.5e-10 PF00158: Sigma54_activat" amino acids 205 to 370 (166 residues), 226 bits, see alignment E=7.2e-71 PF14532: Sigma54_activ_2" amino acids 205 to 375 (171 residues), 72.8 bits, see alignment E=1e-23 PF07728: AAA_5" amino acids 228 to 346 (119 residues), 29.8 bits, see alignment E=1.7e-10 PF02954: HTH_8" amino acids 489 to 522 (34 residues), 32.4 bits, see alignment (E = 1.8e-11)

Best Hits

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 84% identity to azl:AZL_e03970)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>MPMX19_06071 Nitric oxide reductase transcription regulator NorR2 (Azospirillum sp. SherDot2)
MDNDAVISTPSLPLEEAGALVQALDDPARLWPLLLDLMARHLPCDACALLRRDDRAGTGR
AGEGLLVPLATRGLSPDTLGRRFELDEHPRLKAITEAGDGPLRFPAGCELPDPYDGLIPD
LRERLHVHDCVGAPLSVDGRPWGMLTLDALNEGRFEGWEGAIAAWARLAADLAAAMERRA
ALAGDGGTALRILDDPPHGLDFDPIGASPAMASLLTEIDTVAASNLVVLVLGETGVGKEL
VARRLHARSSRAAGPLVHVNCAALPDALVESELFGHVRGAFSGAVADRRGKFELADGGTL
FLDEVGELPLAAQAKMLRALQNGEIQRVGSDRHITVDVRVVAATNRDLAAEVREGRFRAD
VYHRLSVYPLRVPPLRDRGTDVLRLAGLFLERNRARLGLRNLRLSVAAERRMLAYPWPGN
VRELEHAIGRGAIRARVARPPDGGVLTLTPADLGLDEGEGSAVTATVPVRQPRPPEAPEV
PDLPLRDAVEDLERRMIREHLDRHDGNWAQAARSLGLDRSNLFRLARRLGLRE