Protein Info for MPMX19_05312 in Azospirillum sp. SherDot2

Annotation: 4,4'-diapophytoene desaturase (4,4'-diapolycopene-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 TIGR02734: phytoene desaturase" amino acids 1 to 474 (474 residues), 503.1 bits, see alignment E=4.3e-155 PF13450: NAD_binding_8" amino acids 2 to 44 (43 residues), 30 bits, see alignment 7.5e-11 PF01266: DAO" amino acids 3 to 257 (255 residues), 34.2 bits, see alignment E=3.3e-12 PF01593: Amino_oxidase" amino acids 7 to 472 (466 residues), 108 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 42% identical to CRTN_METSP: 4,4'-diapophytoene desaturase (4,4'-diapolycopene-forming) (crtN) from Methylomonas sp.

KEGG orthology group: K10027, phytoene dehydrogenase [EC: 1.14.99.-] (inferred from 60% identity to aca:ACP_2303)

MetaCyc: 42% identical to diapophytoene desaturase (Methylomonas sp. 16a)
RXN-12224 [EC: 1.3.8.2]

Predicted SEED Role

"Phytoene desaturase, neurosporene or lycopene producing (EC 1.3.-.-)" in subsystem Carotenoids (EC 1.3.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.99.-, 1.3.-.-

Use Curated BLAST to search for 1.14.99.- or 1.3.-.- or 1.3.8.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>MPMX19_05312 4,4'-diapophytoene desaturase (4,4'-diapolycopene-forming) (Azospirillum sp. SherDot2)
MLLALTGAKVTVLERQDRIGGRSAGFSLDGYRFDSGPTFFLYPRILEEIFEACGRRLSDD
VDLIRLDPLYRLVFESGGELRVHAQMKALMAEIAKLSPGDADGLPRFLADNRAKMERFRP
VLESDFSSPWALASLPMLKALGRLAPHRSVDRDLSRYFQDPRIRLAFSFQSKYLGMSPFR
CPSLFTILSFLEHEHGIFHPRGGTESVMEAMRRVAESLGVTVRLNETVRHIKFQGRRAVG
VRTDAGDYPADALVINADFARAMTTLVPDDLRRRWSDARIATKKFSCSTFMMYLGIEDKV
DGLDHHTVYLAEDYARNLAEIEECRELPRRPSIYVQNACVTDPDLAPPGGSTLYILVPVG
HQRGHIDWKAEAPHYRRLVLDRLAGFGLTDLERRIRVERVVTPADWDSQFAVHRGATFNL
AHSLDQMLHRRPRNRFEDLDGVYLVGGGTHPGSGLPVIFEGARITARLLAQELGLPTPWR
TKTMGLSGMLRQAVAGGMA