Protein Info for MPMX19_05229 in Azospirillum sp. SherDot2

Annotation: ECF RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 46 to 202 (157 residues), 94.5 bits, see alignment E=2.8e-31 PF04542: Sigma70_r2" amino acids 50 to 118 (69 residues), 64.2 bits, see alignment E=1.1e-21 PF08281: Sigma70_r4_2" amino acids 147 to 199 (53 residues), 50.7 bits, see alignment E=1.7e-17 PF04545: Sigma70_r4" amino acids 152 to 200 (49 residues), 39.3 bits, see alignment E=5.6e-14

Best Hits

Swiss-Prot: 46% identical to RPOE_RHOS4: ECF RNA polymerase sigma factor RpoE (rpoE) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 75% identity to azl:AZL_c02480)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>MPMX19_05229 ECF RNA polymerase sigma factor RpoE (Azospirillum sp. SherDot2)
MPFTRGPLLPGTLNKDGAGSPDADRADADQFGGLVHAVAQDRDRTAFAALFRHFAPKILH
YCLKLGADRSTAEELVQDVMLTVWLKAASFDPAQATVGTWVFTIARNRRIDRLRKEMRPA
PDPDDPAMTPASFATPEETAQMVQSSRQLQDAIETLAENQSEVLRRSYFLEQTHEEIAED
TEVPLGTVKTRLRLALSHLKRSMRDKA