Protein Info for MPMX19_04866 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 755 PF03705: CheR_N" amino acids 11 to 62 (52 residues), 62.4 bits, see alignment 9.2e-21 PF01739: CheR" amino acids 75 to 265 (191 residues), 168.6 bits, see alignment E=3.9e-53 PF13188: PAS_8" amino acids 301 to 354 (54 residues), 19.1 bits, see alignment 3.3e-07 PF00989: PAS" amino acids 302 to 400 (99 residues), 29.6 bits, see alignment E=2.1e-10 amino acids 506 to 615 (110 residues), 30.7 bits, see alignment E=9.8e-11 PF13426: PAS_9" amino acids 312 to 412 (101 residues), 19.9 bits, see alignment E=2.5e-07 amino acids 514 to 617 (104 residues), 24.5 bits, see alignment E=9.7e-09 amino acids 639 to 739 (101 residues), 13.6 bits, see alignment E=2.4e-05 TIGR00229: PAS domain S-box protein" amino acids 506 to 620 (115 residues), 38.5 bits, see alignment E=5.8e-14 amino acids 645 to 742 (98 residues), 23 bits, see alignment E=3.5e-09 PF08448: PAS_4" amino acids 509 to 620 (112 residues), 38.3 bits, see alignment E=5e-13

Best Hits

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (755 amino acids)

>MPMX19_04866 hypothetical protein (Azospirillum sp. SherDot2)
MTKKTDDPDSDFNNLIRHIQESRGIDFRGYKRTSLERRIRRRMEEVGCDGFAAYHAFLEA
HPQEFVDLLNTVLINVTSFFRDGEAWEVMRREVVLRMLERKGDQAPIRIWSVGCASGEEP
YSLAMMFAEALGTAEFCRRVKIYATDLDDAALNTARHATYGPRDVESVPEPLLERYFERI
GNHYVFQRDLRKCVIFGRHNVVSDAPISRIDLLICRNLLIYLEADTQGVVLPRLHYALVN
DGFLFLGKAETQLARSRMFEPVDLKSRIFAKVPQEWRRSAGGSLSLANDAGSPRVNQQVR
LLESIVDGSSTGYLAVNAEGVLVFANTHARRLFDVEESDIGRPFQDLTISYRPTELRSRI
EEVRNSGRMVRIEHQPFTRPGAEPVRLTIEVSPLYSRDGKAFATLLSFFDTSRVYLLQQE
IEAAQESLETTIEELQSSNEELETTNEELQSTNEELETTNEELQSTNEELETMNEELRST
NEELEVANEEMRRQSEEAGEYRLYSESILRSIDVGIIVLDDNLTVQSWNRWSENVWGLRN
EEVMGEVFLDLDIGLPVQRLRRPLHDILTTQAAVEPVEITVMDRRGRRIACRIRLSPLLY
DTRLARGVVLIIEDVTERARSDAFAEYLGRIIGESLNEVYFIDPATFSFQLVNKGAELKL
GYSLESLRQIALHDLMPDIDALAFTRLVGPLLSGEKAEIVFETTIEAPDQTLRPMEICMQ
YFAEEQPPILVAMAHDVTERQRIGLDDSRAEVVGS