Protein Info for MPMX19_03482 in Azospirillum sp. SherDot2

Annotation: Gamma-glutamylputrescine oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 26 to 41 (16 residues), see Phobius details PF01494: FAD_binding_3" amino acids 28 to 60 (33 residues), 22.5 bits, see alignment (E = 1.3e-08) PF01266: DAO" amino acids 29 to 385 (357 residues), 184.5 bits, see alignment E=8.4e-58 PF00890: FAD_binding_2" amino acids 29 to 59 (31 residues), 24.6 bits, see alignment (E = 2.9e-09) PF13450: NAD_binding_8" amino acids 32 to 73 (42 residues), 29.1 bits, see alignment 2e-10

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 49% identity to sme:SMc03132)

Predicted SEED Role

"FAD dependent oxidoreductase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>MPMX19_03482 Gamma-glutamylputrescine oxidoreductase (Azospirillum sp. SherDot2)
MLDYPNTYYSATRRPANDHAPLRGTVAVDVCVIGGGLAGLSTAWELIRRGRSVALIEAQR
IGWGASGRNGGFVLQGWSEGLRNIEARCGRDHARALFGLSVEGVEIVRDTIAGNSLPGCN
PTTGKLSVTRYEAAGQLQRHRDHMAQSYGYEFTYIDRPTLRGLLKSDLYFQGLRDLVGFH
FHPLNYCLGLADLIAGAGGRLFEGTAMIGMSRTDTPGSGGRWRVDAVDGSVLCHDVVMCG
GGYGGPEFGALRRAFLPIATYVVLTERLGDRLADFVATTDAVGDDRRSSDYYRIVDGDRL
LWGGRITTRCEQDEQRLAAMLRQDIGGVFPGLADVRIEKAWSGLMGYARHKMPHIAKIED
GLWSCSSFGGHGMNTAPIGGRVVAEAITGESDRIRFFAPYGLTWNGGIFGPPAAELVYTG
LRLMDFWQESRSRRQGA