Protein Info for MPMX19_03023 in Azospirillum sp. SherDot2

Annotation: Maltose O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF12464: Mac" amino acids 12 to 63 (52 residues), 42.9 bits, see alignment E=7.1e-15 PF14602: Hexapep_2" amino acids 135 to 170 (36 residues), 36 bits, see alignment 6.7e-13 PF00132: Hexapep" amino acids 136 to 170 (35 residues), 39.3 bits, see alignment 5.1e-14

Best Hits

Swiss-Prot: 67% identical to NODL_RHILV: Nodulation protein L (nodL) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K00661, maltose O-acetyltransferase [EC: 2.3.1.79] (inferred from 76% identity to psa:PST_3480)

MetaCyc: 51% identical to maltose O-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Maltose O-acetyltransferase. [EC: 2.3.1.79]

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>MPMX19_03023 Maltose O-acetyltransferase (Azospirillum sp. SherDot2)
MQTSDGRSEKEKMLAGDLYDASAPEIQADQVAAKEWMVRYNAALALPAGDRRTLLLERFA
AVGEGAVIRPPFHCDYGYNISLGAGVFLNFNCVILDVVAVTIGDKTQIGPGVQILTADHP
RDFATREAGLEFGRPIHIGRNVWIGGAALILPGVTIGDDAIVGAGSVVTRDVPAGATVMG
NPARVR