Protein Info for MPMX19_02983 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13531: SBP_bac_11" amino acids 35 to 297 (263 residues), 67.6 bits, see alignment E=2.9e-22 PF01547: SBP_bac_1" amino acids 38 to 288 (251 residues), 60.5 bits, see alignment E=5.9e-20 PF13416: SBP_bac_8" amino acids 49 to 312 (264 residues), 105.4 bits, see alignment E=1e-33 PF13343: SBP_bac_6" amino acids 84 to 335 (252 residues), 80.7 bits, see alignment E=2.4e-26

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 58% identity to vei:Veis_0200)

Predicted SEED Role

"ABC transporter substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>MPMX19_02983 hypothetical protein (Azospirillum sp. SherDot2)
MRSVMCGLMATAALWCGMAAVQTAQAQEKTLYVAAYGGSFEQTMRKDIIPAFEKAMGVKI
EYVAGNSTDNLAKLQAQRGNQQIDVVILDDGPMYQAVALNFCADLEKAPVYDQLYDLAKM
PSGKAVNFGAVGTGILYNKAYFDENKIPAPASWKDIEDPRFKKKLAIPPINNSYGLHALV
MMARLNGGGETNIEPGFKEFKDKINPNVLAYEPSPGKMTELFQSNQAVIAVWGSGRAKAL
ADTGFPATFVYPKEGGIVLGSAACQVAGSKNAPEAQKFIQHMLGVEAQTALAVSAGFGPV
NKTVELPAEKQAGIPYGPEQVGKLLVVDWDTINKNREIWNKRWTREIER