Protein Info for MPMX19_02562 in Azospirillum sp. SherDot2

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01406: DNA polymerase III, epsilon subunit
  • amino acids 2 to 221 (220 residues), 284.9 bits, E=4.9e-89
• TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family
  • amino acids 3 to 171 (169 residues), 174.5 bits, E=2.2e-55
• PF00929: RNase_T
  • amino acids 4 to 163 (160 residues), 135.3 bits, E=1.5e-43

Best Hits

Swiss-Prot: 58% identical to DPO3E_RICFE: DNA polymerase III subunit epsilon (dnaQ) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 96% identity to azl:AZL_000050)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Protein Sequence (227 amino acids)

>MPMX19_02562 DNA polymerase III subunit epsilon (Azospirillum sp. SherDot2)
MREIVLDTETTGFKPEEGHRLVEIGCIELVNHLATGERFHVYLNPERDMPPEAFAVHGLS
TEFLADKPLFNDVAADFVAFIGDAPLVIHNAAFDMHFLNWELKIAGYPVMPKDRAVDTLL
MARQKFPGSPATLDALCKRFGVDNSNRTLHGALLDAQLLAEVYLELLGGRQTGLSFAGGP
ASKGGVASPVRIDRPFREARVFAVSDDEVAAHAEMLKKIKNPLWAVE