Protein Info for MPMX19_01794 in Azospirillum sp. SherDot2

Annotation: Putative cysteine protease YraA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18011: Catalase_C
  • amino acids 6 to 116 (111 residues), 26.7 bits, E=3.9e-10
• PF01965: DJ-1_PfpI
  • amino acids 8 to 176 (169 residues), 193.5 bits, E=2.4e-61
• TIGR01382: intracellular protease, PfpI family
  • amino acids 10 to 175 (166 residues), 174.1 bits, E=9e-56

Best Hits

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 92% identity to azl:AZL_021920)

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.-

Protein Sequence (190 amino acids)

>MPMX19_01794 Putative cysteine protease YraA (Azospirillum sp. SherDot2)
MAQKLDGKTVAVLATDGFEQVELTEPVKALRDAGATVHVVAPKGGQIQGWNHHDRGDMVD
VDVTLDQADAGRYDALLLPGGVMNPDSLRLEPKAIAFVKSFVESGRPIAAICHGPWTLID
AGGVRGKRMTSWPSLQTDLRNAGASWVDEQVVTDHGLVTSRKPDDIPAFCRKMIEEFCEG
RHAGHRHAAE