Protein Info for MPMX19_01758 in Azospirillum sp. SherDot2

Annotation: Arginine exporter protein ArgO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF01810: LysE" amino acids 22 to 207 (186 residues), 115.1 bits, see alignment E=1.5e-37

Best Hits

Swiss-Prot: 47% identical to Y488_MYCTO: Putative amino-acid transporter MT0507 (MT0507) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 87% identity to azl:AZL_021560)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>MPMX19_01758 Arginine exporter protein ArgO (Azospirillum sp. SherDot2)
MTELSTAVLLPAFLPGLFLGFSLIVAIGAQNAFVLRQGLRNEHVLAICATCALSDAVLIL
VGVSGFASAGARWPWLEPLMRYAGAAFLLVYGLRSARSAWQGGSGGLNPADREPGGLLPA
LLTCLALTWLNPHVYLDTVVLVGSVSARFAEARGAFALGAMTASFLFFFALGYGARLLRP
LFARPAAWRVMDGGIALVMWAIAVGLLFG