Protein Info for MPMX19_01581 in Azospirillum sp. SherDot2

Annotation: ATP-dependent RNA helicase DbpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 808 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 1 to 775 (775 residues), 1113.5 bits, see alignment E=0 PF00270: DEAD" amino acids 3 to 165 (163 residues), 96.9 bits, see alignment E=2.9e-31 PF04851: ResIII" amino acids 7 to 162 (156 residues), 27.9 bits, see alignment E=5.1e-10 PF00271: Helicase_C" amino acids 218 to 323 (106 residues), 59.5 bits, see alignment E=9.5e-20 PF19306: WH_Lhr" amino acids 352 to 511 (160 residues), 149.4 bits, see alignment E=1.6e-47 PF08494: DEAD_assoc" amino acids 566 to 747 (182 residues), 172.7 bits, see alignment E=2e-54

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 95% identity to azl:AZL_019380)

Predicted SEED Role

"FIG003033: Helicase domain protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (808 amino acids)

>MPMX19_01581 ATP-dependent RNA helicase DbpA (Azospirillum sp. SherDot2)
MVEAAERGESALLIAPTGGGKTLAGFLPSLIELAERPREGLHTLYISPLKALAVDIQRNL
EQPIAEMRLPIRAENRTGDTPEAKRRRQRTHPPHMLMTTPESLALLLSYTDADKLFRTLR
CVIIDELHALAGTKRGDLLALGLARLSRLAPAARRVGLSATVAEPERLLAWLSRRGRHDG
SDSDDVRLVLGRSGAQAEVEILTSQERVPWAGHMAMHAMKEIYERVRRQRTTLLFVNTRA
QAELVFQALWRVNDDNLPIALHHGSLAVEQRRKVEGAMARGELRAVVATSSLDLGIDWAA
VDLVVQIGAPKGSSRLVQRIGRANHRLDEPSRALLVPANRFEVLECRAALEAVHDHTLDG
EAPRPGGLDVLSQHLLGMACAAPFLPDQLYEEVVSAAPYAAMTRDEFDDVLDFVTTGGYA
LGAYDRFQRLKLREDGRMAVAGPAVARQYRMNVGTITQEALLRVRLNRGPVLGEVEEYFI
QGLTPGDTFLFAGQLLKFLGVREMEAQVAKGGTGDPKVPAYAGGRLPLSTHLAERVRAML
ADPRQWDGLPEDVQEWLRLQRHRSVLPNRDGLLVETFPKAGKQFLVAYAFEGRNAHQTLG
MLLTRRMERFGLGPLGFVATDYVLAVWSLRSPTDMDALFDQDMLGDDLEAWMDESSMLRR
TFRNVALIAGVIDRRHPGQEKTGRQVTFSSDLIYDVLRKHDPGHVLLRATRADAAGGLTD
IRRLSDFLARVRGRITHKALDRISPLAVPVILEIGRERVDGSATDELLAAAEAELLAEAM
PELAPPRPAKTKTGRPQQGRPQQGRLSL