Protein Info for MPMX19_01514 in Azospirillum sp. SherDot2

Annotation: Ribosomal RNA small subunit methyltransferase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 42 to 293 (252 residues), 242.2 bits, see alignment E=2.8e-76 PF00398: RrnaAD" amino acids 42 to 290 (249 residues), 186.1 bits, see alignment E=3.5e-59

Best Hits

Swiss-Prot: 68% identical to RSMA_MAGSA: Ribosomal RNA small subunit methyltransferase A (rsmA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 96% identity to azl:AZL_018600)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>MPMX19_01514 Ribosomal RNA small subunit methyltransferase A (Azospirillum sp. SherDot2)
MPYKSGMTDPISAPAAPAPTPAAFDPHALPPLRDVIARFGLEARKSLGQNFLLDLNLTGR
IARSANLPAGTTAIEVGPGPGGLTRALLATNAVKVIAIERDRRFIEALADVIEASQGRLS
IVEADALNVDPEELAPAPRAIVANLPYNVATPLLLGWLARIEAYVSLTLMFQKEVADRLV
AKPGSKAYGRLSVITQWRSDARVLFNLPPRAFTPPPKVESTVVHLTPRANPEPADWRALE
QVTAAAFGQRRKMLRQSLKSLGSAEALLEETGIVPTARAEEIDVAGFAALARAFRARNPL
ESPA