Protein Info for MPMX19_01440 in Azospirillum sp. SherDot2

Annotation: Multidrug resistance protein MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 57 to 384 (328 residues), 265.3 bits, see alignment E=3.2e-83 PF16576: HlyD_D23" amino acids 81 to 303 (223 residues), 73 bits, see alignment E=3.2e-24 PF13533: Biotin_lipoyl_2" amino acids 84 to 129 (46 residues), 50.8 bits, see alignment 1.7e-17 PF13437: HlyD_3" amino acids 193 to 293 (101 residues), 28.5 bits, see alignment E=3.2e-10

Best Hits

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 84% identity to azl:AZL_017630)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>MPMX19_01440 Multidrug resistance protein MdtA (Azospirillum sp. SherDot2)
MRRFFLVLLLAAVIGGGGYYWYATHNAGADGKTAAADGQKPQSKAAAPAGAGRTVPVVTQ
TVAVQAVPEQIVTIGSVQPIAAIAIKARVDSAVETVNFTEGQEVKTGDTLFTLDSRSLDA
QLRQAQANLERDRANLEKAKGDVKRYAELVRTSAISRTTYDAAVATADALEGTVKADLAA
IEAAKVSLSFTRITAPMDGRTGTVAAKVGTMVRAADTNPLVTLTQLRPINVSFNVPEKHL
PAIRAAMASGSLSVTATIAGGHGEKAEGKLSFVDSQVDQQTGTILVKGEFPNADTRLWPG
QFVDTVLTLRVEQNALTIADLAVQTGQKGRFVYVVKADETVEVRPVTVERNHGGLSVVAS
GLKAGERVVVDGQSRLFPGAKITEKAGGKPAAPTGSTGGGETAEGGRQQGSATQDAARST
ATNGAATGQSAEGKSTGGAT