Protein Info for MPMX19_01098 in Azospirillum sp. SherDot2

Annotation: Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 47 to 60 (14 residues), see Phobius details TIGR03182: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit" amino acids 24 to 336 (313 residues), 505.8 bits, see alignment E=1.9e-156 PF00676: E1_dh" amino acids 32 to 328 (297 residues), 336.5 bits, see alignment E=6e-105

Best Hits

Swiss-Prot: 74% identical to ODPA_RHIME: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 94% identity to azl:AZL_015210)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>MPMX19_01098 Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha (Azospirillum sp. SherDot2)
MAASRRRSTKALTDTAPAQAVSSEELLHYYREMLLIRRFEEKAGQLYGMGLIGGFCHLYI
GQEAVVVGVQAALKDGDSVITSYRDHGHMLACGMEAKGVMAELTGRIGGYSKGKGGSMHM
FSQEKNFFGGHGIVGGQVPLGTGLAFAHKYSNDGGVAAVYCGDGAINQGQVYESFNMAAL
WKLPVLFIIENNKYAMGTSQERASAGELHQRGAAYGIPGYQVNGMDVLEVKAAADQWVPH
IRGGNGPVILEMKTYRYRGHSMSDPAKYRTKEEVEKMRSESDPIDQLKAKILAGNHADED
KLKEIDRQVKAIVTESAEFAQQSPEPDPSELWTDILV