Protein Info for MPMX19_00951 in Azospirillum sp. SherDot2

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 715 PF17191: RecG_wedge" amino acids 40 to 195 (156 residues), 32.3 bits, see alignment E=1.8e-11 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 56 to 678 (623 residues), 675.1 bits, see alignment E=6.2e-207 PF04851: ResIII" amino acids 292 to 445 (154 residues), 28.2 bits, see alignment E=4.2e-10 PF00270: DEAD" amino acids 306 to 450 (145 residues), 76.5 bits, see alignment E=5.4e-25 PF00271: Helicase_C" amino acids 490 to 600 (111 residues), 60.2 bits, see alignment E=5.5e-20 PF19833: RecG_dom3_C" amino acids 629 to 696 (68 residues), 52 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 96% identity to azl:AZL_016620)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (715 amino acids)

>MPMX19_00951 ATP-dependent DNA helicase RecG (Azospirillum sp. SherDot2)
MTQEGPPGFLVAVEGFPGSDPPVRPAILFPLFKPVTALPGLGPRLGKLVEKLAGAHVVDL
LWHLPCGVVDRRFSPKIAQAPHGRIATLTVRIDSHAPPVNPRHPYKIRCTDETGVLELVY
FHIRGDWLSKQIPAGTTMVISGKVEWFNDTAQITHPDAVVPVDAKEDLELVEPVYPMTAG
LPAKTLRKAVRAALNDVPPLDEWQDPAWLSRRQWPTWAEALKRAHTPEDEGDLAATAPIR
CRLAYDELLANQLALMLVRASQRRLAGRATQGDGSLRRAALAALPFSLTGSQAGSLEEIY
ADMAAERRMLRLLQGDVGSGKTVVALMAMLNAVETGAQAALMAPTEILARQHAESLAPLC
RAAGVEIGLLTGRDKGKARQAVLDRLASGELPLLVGTHALFQEDVAFKDLALAVIDEQHR
FGVHQRLQLSAKGRAVDVLVMTATPIPRTLTLTAYGDMDVSRLTEKPAGRKPVQTVTIAL
DRLEEVVNGIQRKVTEGARVYWVCPLVDESEQSDLAAATERHAFLRATFGDRVGLVHGKM
RGPDKDAVMAAFAEGSLDVLVATTVIEVGVNVPEATVMVIEHAERFGLAQLHQLRGRVGR
GEKPSSCLLMFESNLTETARARLKTLRDTEDGFVIAEEDLRLRGAGEVLGTRQSGLPGFR
MADLAVHGDLLAVARDDARLVVERDPDLASPRGQALRTLLYLFERDAAAKTLRSG