Protein Info for MPMX19_00731 in Azospirillum sp. SherDot2

Annotation: Thiamine-monophosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 7 to 330 (324 residues), 296.4 bits, E=1.1e-92
• PF00586: AIRS
  • amino acids 31 to 143 (113 residues), 101.6 bits, E=3.6e-33
• PF02769: AIRS_C
  • amino acids 155 to 307 (153 residues), 43.3 bits, E=4.4e-15

Best Hits

Swiss-Prot: 43% identical to THIL_SALTY: Thiamine-monophosphate kinase (thiL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 90% identity to azl:AZL_010130)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Protein Sequence (330 amino acids)

>MPMX19_00731 Thiamine-monophosphate kinase (Azospirillum sp. SherDot2)
MTTPTLGEFGRITRFFKPLAAGFPGARGLRDDAAVFGVPDGRELVVTTDAMVAGVHFFPD
DAPADIAAKLMRSNLSDLAAMGAEPLAYTLVTALPRGLDESWLEGFAAGLGEEQRQFAIA
LAGGDSVSTSGPITLSVTAFGLVPTGRALPRWGGQPGDRVFVTGSIGDAALGLEVAYGRL
DIPDQDTRAHLLRRMRRPDPRMGIGPRLIGLASGAMDVSDGLVADLGHLCEESGCAALLH
ADAVPLSEAARGAIDGDPLRLALAITGGDDYELLFTAPPSARDALTALAAECGVAITEIG
ELRPGTPGEVAVLDGAGAPLPLTRRGWDHF