Protein Info for MPMX19_00714 in Azospirillum sp. SherDot2

Annotation: Ferrous-iron efflux pump FieF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 22 to 298 (277 residues), 217 bits, see alignment E=1.7e-68 PF01545: Cation_efflux" amino acids 25 to 217 (193 residues), 135 bits, see alignment E=2.9e-43 PF16916: ZT_dimer" amino acids 222 to 298 (77 residues), 88.2 bits, see alignment E=3.2e-29

Best Hits

Swiss-Prot: 45% identical to FIEF_PECAS: Cation-efflux pump FieF (fieF) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 92% identity to azl:AZL_009960)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>MPMX19_00714 Ferrous-iron efflux pump FieF (Azospirillum sp. SherDot2)
MGEPVSDNAGNAASADRLRRYATYASVSVASTLIAAKLGAYLLTESVSILSSLIDSCTDL
MASVVTLLGVRHALRPADANHRFGHGKAEALAALAQAAFIGGSAVLLSIEAVRRLVRPEP
IAEGTMGIAVMLLSILLTAGLITFQRRVQVATGSVAIGADRLHYSGDLLMNGAVIVAILL
TEATGLTVVDPLFGIGIALFLLNGARGVARDALDVLMDRELAEEERGRIAELALAEPGVR
GLHDLRTRNAGTGCFIELHLELDGGLTLTAAHEIADRVETRLRDAFANAEVLVHQEPAGL
VDERLDHRIAG